Guest Post by
Scientist James Lyons-Weiler, Ph.D., said at least 10 people asked him about the snake venom proteins in relation to COVID-19. He proposed two possible explanations, one of which he favors over the other.
Dr. Meryl Nass said the snake venom stuff is “hooey.” My analysis says yes, let’s move on to more productive pathways.
I share two possible explanations for their presence in COVID-19 patients, one of which I favor over the other.
Snakes were first floated as a potential intermediate host organism by a very early speculative report covered by SciAm in Jan 2020 that found codon usage bias most similar to snakes of all things.
Codon usage bias is determined by the percentage of times specific codons (triplet nucleotides) are used to bring specific amino acids in place in protein sequences.
It’s suggestive, but very, very weak and has not been taken seriously by anyone as sufficient evidence indicating snakes were the intermediate hosts.
Reading the 2021 venom paper cited by Bryan Ardis, here is my breakdown:
In Italy, with 20 COVID-19 samples and 10 control (non-COVID-19 patients), 5 plasma samples from COVID-19 patients and 3 fecal samples had evidence of proteins of unknown origin detected using a protein assay that led to the finding of animal venom proteins in their blood or feces.
They sequenced the proteins and found multiple types of venoms, including snake venom proteins.
That’s it. It’s a small study.
Here’s one amino sequence from their study that seems to share similarities across many of the venom types from different animal species:
MKLVLAIVLILMLVSLSTGAEESGQEISMVGPPLYIWDPIPPCKQLDEDCGYGYSCCEDLSCQPLIEPDTMEITALVCQIESA
(Learn how to analyze DNA and RNA sequences this summer in our Bioinformatics class at IPAK-EDU taught by yours truly.)
This polypeptide has only a single match in all of the trees of life. It matches a toxin from Conus pulicarius. Here’s a photo:
Conus pulicarius, a common name the flea-bitten cone, is a species of sea snail, a marine gastropod mollusk in the family Conidae, the cone snails and their allies. (Source: Wikipedia).
The distribution of this sea snail is: Central and Western Pacific; Polynesia (not Marquesas); Cocos (Keeling) Island, New Guinea and Australia (Northern Territory, Queensland and Western Australia).
So the study found venom proteins in patients in Italy from animals other than snakes, and those in snakes and the sequences of these venoms are all pretty similar to each other.
The match is 100% and extends over the full length of the sequence.
Pretty good match, I’d say.
But — that’s because it’s a match — to itself.
This protein does not match any SARS-CoV-2 proteins. Neither do any of the other venom proteins.
The study actually has no evidence and makes no claim of these polypeptides being encoded by the SARS-CoV-2 virus. It only reports that the venom proteins were found in SARS-CoV-2 patients, but not controls.
Metabolites?
Here’s a link to a news article about a study that says that metabolites in COVID-19 patients — products of the human body — can be toxic and can be like snake venom.
Here’s a link to the same story, but from a different source.
And, here’s a link to the study they reference on the human secretory phospholipase A2.
Does this mean the human body produces venom in response to SARS-CoV-2 infection?
There is no match between the human secretory phospholipase A2 protein.
Animal venoms as treatments for autoimmunity?
Now check this out, some studies are finding venoms, including snake venoms, can reset the CD4/CD8 imbalance seen in serious cases of COVID-19:
“Many toxins are multifunctional and have several biological targets which may have no relation with their toxic role. Some toxin-derived peptides are now being used to treat type 2 diabetes, hypertension, neuropathic pain, and other medical disorders.
“Some data confirm the effect of bee venom (BV) on preventing COVID-19 and improving it [1]. Some other data ignore the BV effect on preventing COVID-19 and hypothesize that less SARS-CoV-2 infection in beekeepers is due to their less exposure to other people [3].
“A low dose of botulinum neurotoxin (BoNT) can reduce the symptoms of COVID-19, and so, it could be used in treatment lines [14]. It has demonstrated that the rate of DTP vaccination has an inverse correlation with COVID-19 prevalence [15].
“Cobrotoxin has an anti-inflammatory effect and also can restore the CD4/CD8 ratio and perform immunoprotective activity against SARS-CoV-2 [16]. Tetrodotoxin is an inhibitor of MPro of SARS-CoV-2 and so can affect the virus [17].”
Some relevant questions:
- Five control samples are too few. How many people w/out COVID-19 have the protein in their blood or feces?
- Were these patients treating themselves (or under the care of doctors) for COVID-19 (or another autoimmunity) with animal venoms?
We know that patients with severe COVID-19 most likely already had autoimmunity. It’s about 80% in severe COVID-19 with autoimmunity compared to about 8% in mild COVID-19. That’s a huge difference in the prevalence of autoimmunity associated with COVID-19 outcomes.
My favored hypothesis is that autoimmune patients in Italy using animal venoms to treat their autoimmunity — or to ward off COVID-19 — have confused the heck out of scientists who find those venoms or metabolites thereof in their feces and blood.
But it’s also possible that we produce proteins in response to SARS-CoV-2 infection that match venom in other species. Unlikely, but I can’t rule it out.
Here’s an article on Venom Immunotherapy from Brazil with extensive citations of studies of venom proteins to treat autoimmunity.
Remember, SARS-CoV-2 was touted as “everyone is going to die” — and the link between prior autoimmunity and serious SARS-CoV-2 is very, very strong.
I’d be curious to learn if anyone has any leads on the prevalence of animal venom injections in use to either treat autoimmunity or attempts to treat COVID-19 in Italy.
If you consume snake venom… well, it’s a protein, and knowing what happens to proteins in our stomachs is just an internet search away.
I don’t have a definitive answer but I know the venom has to be injected or produced endogenously to be found in the blood or feces of anyone.
It is my sincere desire to provide readers of this site with the best unbiased information available, and a forum where it can be discussed openly, as our Founders intended. But it is not easy nor inexpensive to do so, especially when those who wish to prevent us from making the truth known, attack us without mercy on all fronts on a daily basis. So each time you visit the site, I would ask that you consider the value that you receive and have received from The Burning Platform and the community of which you are a vital part. I can't do it all alone, and I need your help and support to keep it alive. Please consider contributing an amount commensurate to the value that you receive from this site and community, or even by becoming a sustaining supporter through periodic contributions. [Burning Platform LLC - PO Box 1520 Kulpsville, PA 19443] or Paypal
-----------------------------------------------------
To donate via Stripe, click here.
-----------------------------------------------------
Use promo code ILMF2, and save up to 66% on all MyPillow purchases. (The Burning Platform benefits when you use this promo code.)
I’m going to give this a little more time to play out.
This is Q level bullshit, people. This story is so obviously insane it could only be floated in order to distract from whatever the truth is- and that’s that the flu was used as a super weapon against freedom in order to push the globalist agenda one step further.
That’s the only explanation they don’t float and never want you to consider.
Anyone who truly believes that the flu is some form of weaponized snake venom is not in the game.
YMMV.
^^^^
Their craft templated from a 2005 era prototype QAnon:
TPTB were getting owned by the 911 Truth movement and suddenly the internet was awash in ridiculous claims of planes as holograms, nukes being used to demolish WTC bldgs, UFO involvement, etc. That simmered for a year, then Benjamin Chertoff (cousin of dual-citizen DHS Sec. Michael Chertoff) penned a MSM boosted article in Hearst publication Popular Mechanics to strawman how crazy the Truther movement was.
Thereafter the signal-to-noise ratio for intelligent free inquiry was wrecked so the psyop was a success. Having to address endless BS arguments about the crime scene made open peer review impossible and, like Dealy Plaza, relegated the pursuit to only passionate but irrelevant hobbyist detectives. Or Julian Assange types, R.I.P. old boy.
Winning against an OPFOR, whose budget is the remaining faith and momentum of the dollar, to deprogram its brainwashed zombie audience requires novel solutions. Maybe a GPT-3 driven Zerg rush of social media for years on a reformed TwitterX, dunno.
Q level bullshit is Trump, JFK junior or some entity will save us. This has nothing to do with that. This has to do with the same 14 side effects of snake venom and covid are exactly the same. Just a coincidence. There are no coincidences. Ardis gives a lot of good evidence.
As with the 911 Truth movement, what is more important than the minutiae of the murder weapon’s use, but bringing the murders to justice now.
Yes, refined QAnon had the “patriots sit on your asses and trust The Plan” invitation to apathy. But they also jammed the channel with lots of intentional noise. A very limited hangout for credibility plus a social media fast-tracked rumor mill for damaging truth seeker reputations. They didn’t spill the beans on the actual mechanism of the true crime.
Its all variations on military psyops, leaflets dropped out of airplanes about the folks back home drinking fish tank cleaner to get rid of covid-19. Just now its online and the enemy are taxpayers with an expectation of rule-of-law.
But screw it, lets all become herpetology experts while Fauci, Schwab, Gates, Daszik, Tederos, Li, Collins, etc sneak off into the night having conducted the greatest mass murder in history.
“As with the 911 Truth movement, what is more important than the minutiae of the murder weapon’s use, but bringing the murders to justice now.”
EXACTLY!
The Q crowd behaves like a cult, and so it was known that they’d enjoy consuming a new morsel of hidden knowledge, and that that knowledge would cause distraction and division. It makes one feel so special and enlightened to receive another piece of the puzzle. It’s like dopamine, and people get cranky when someone wants to take away their dopamine hits.
The Q believers act like religious zealots, and don’t tolerate any dissent towards the priests who deliver to them privileged information, or towards the information itself. The latest distraction leads people away from focusing on what was going on in all those biolabs in Ukraine.
Since the regular flu (whatever that is) disappeared, plus many other anomalies I have not fully believed there is a covid19. I read here on TBP all of the time commenters saying they got Covid, however.
There is a huge psychological aspect to this, but I give them benefit of doubt.
IF you are going for a bio weapon snakes fit the bill better than bats. They are REALLY into snake venom.
I just heard that venoms have a relationship to parasites. This has been my own favorite theory about flus in general (besides toxins), and the rest. Simply because anti parasitical drugs and natural remedies work, or help, with ALL OF THIS. I haven’t heard good explanations why this should be the case- just HOW they work.
Can you put parasites in specific waterways? At least as easily as fluoride, etc.
Anyway transmission is another aspect and just as logical as ‘lots (different) of vaxxxines to specific areas’. Though it’s not necessarily either/or.
I do see the usual aspect of somebody getting a theory and falling in love with it. This has obviously been the downfall of science, history, etc. or it may only be a partial explanation.
Of course health compromised people get sick. It seems studies show (ha!) that venom goes straight to inflamed organs (comorbidities) to attack. Your pancreas (diabetes), heart, etc. spleen (blood). That’s interesting.
We must always remember that in the past we did not run to the doctor or test for the flu.
Once you start testing, numbers of all sorts get jacked.
Totally.
It is interesting that the PCR test has been used extensively in venom victims and studies.
Hate it but past this point volks, military science is going to give us better results against the Snakes in Suits than medical science.
Yep, once you start testing it generates cases, just like all the cancer screening generates new customers for the cancer industrial complex.
Aside from the venom theory being a hoax, do any of you “Q” knowledgeable folks remember back a year or two ago when the “Q” stuff was thick and heavy that a photo of Trump with some foreign leaders came out and it seems it was entitled “Watch The Water”? Or it might have been another photo right around that same time. Maybe someone new the venom BS was part of the script.
At the end of Watch the Water, the good Dr. had an ample list of preventative products that paralleled his theory. Hmmmm, what a co-inky dink! I wonder how his sales those products increased after that viewing?
Spiking the water sources would be so momentous in size and scope it would be rather obvious.
I think it’s obvious many have not actually watched the 3 part interview with quite a bit of documentation. The water part is really just a side note. They have been mass producing the synthetic venom for a long time, too.
I don’t know if this is ‘it’ but it’s not a farce. Many of the negative comments are weird, especially the ones saying that Ardis is ‘not an expert’. He’s not, but through out this whole debacle the experts are bad -who trusts them?
I saw the other scientist who was talking about this (venom)from almost the beginning. He had an old saying from treatments of witch drs to now, something like: a little bit of poison can heal you, a lot of poison kills you. The basis for homeopathy. (Not sure if the word was poison).
Anyway, I said earlier I think they may have just said HEY let’s use venom for this mRNA shot because it works so well in so many ways. Also they (all of the psychopathic pharma etc companies) have been investing a lot into all aspects of venom. He has the documentation for this too.
Then, oops. Okay let’s study how much is going into the sewer, who is dying and why, etc. Don’t tell them treatments cuz we want to let this play out…
If it is true that the ‘spike protein’ is an actual protein in (various?) snake venoms, then it showing up as a feature of “the virus” is not an accident or coincidence. And, it sure didn’t happen because a snake was an intermediate host (LOL, we’re back to that again? Really?).
I did see all 3 parts, and you cannot hide the evidence that supports that snake venom has the same side effects as covid. I already had in my mind that virus is just another term for toxins or poisons.
Much of what is being presented is probably true, but what are they trying to distract us from? And like someone else on this thread commented, we should be focusing on bringing the perpetrators to justice more than on these details. Multitudes have died, and many more will die, because this situation is still a long way from being over.
The bat virus was engineered in Wuhan to exquisitely bind to human ACE2. Let’s start with what we know and not go Qtard.
I have a friend who is quite awake. He won’t take the vax because he knows what is going on. Last spring we talked about prions, mad cow disease, and the jabs. And now his coworker’s fully vaxxed dad recently died an agonizing death from a prion related disorder.
This guy, however, still believes in all things Trump. He followed Q-anon and was one of those who thought Trump would reclaim the presidency in March of 2021, well after Creepy Joe’s inauguration.
He sent me this water video before it went completely viral on the alt net but he couldn’t explain why more people didn’t get sick if the water supply was tainted. He became defensive as I expressed my skepticism and told me he “wasn’t stupid”.
I replied that he was the one who believed Trump was playing 6-level chess and he was wrong. Furthermore, he is still trusting all the same sources (like X-22 Report, Health Ranger Mike Adams, etc) for this “water” video that misled him on Trump and Q-anon’s secret plans.
So I sent him this and other articles like Steve Hirsch’s post from yesterday, and he still believes snake venom might be in the water.
So, yeah, it’s likely just another psyop designed to split the ranks of those who would oppose the NWO.
Deceive the Snowflakes and confuse and divide the Deplorables who always underestimate the treachery of the luciferian elite. These folks are like perpetual Charlie Browns ever chasing Lucy’s disappearing football. Over and over and over again.
Now snake venom appears to be trending all over the alternative net.
But it looks like just another channel change to me.
When will people learn? And why do those on both sides of the political spectrum always want to believe so bad anyway?
Take your pick:
Meh. Speedy, fair trials and I-95 lamp posts.